Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name YPR196w
Description Putative maltose activator
Aminoacid Sequence
Download FASTA
>YPR196W YPR196W
MSIVRQSCDCCRVRRVKCDRNRPCDRCRQRNLRCTYLQPLRKRGPKSIGESNLERAAEIQ
MVTVNNNIMAAPVMYKKVPKKVIDQCLRLYHDQLYVIWPMLSYDDLYKLLEENYEDCSTY
WFLVSLSAATLSDLHTKIEYKKGFFFAGEQLCNLCMSSRRFFDDLSNSDIFRIMTYYCLH
RCYAQFADTRTSYRLSCEAIGLIKIAGFHREETYEFLPFGEQQLIRKVYYLLLMTERYYA
VYIKCVTSLDTTISPPQPEIVTDSRLSLDSFLEVIKVFTVPGKYFYDALATNSVNGSYTE
DSLKRIWNELHISSLDIEPYSYGYIDYLFSRHWVRTLAWKLVLNKKDMRMNFFSNTNATH
IPVEIAKDMLQDTLLTPIDLYDVHGPVIPMKALEIANALVDVVSKYDHNMKLEAWNILCD
VSKFVFSLKHCNHKMFQRFSTKCQSALIDLPISRPLRLNDDSKDEVDIIP* 
Transcription Factor
Binding site(s)
CGGagaAWt
axxtxDaWTTctCCGaxxaxt
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator