Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Yap3p
Description basic leucine zipper (bZIP) transcription factor
Aminoacid Sequence
Download FASTA
>YHL009C YAP3
MTPSNMDDNTSGFMKFINPQCQEEDCCIRNSLFQEDSKCIKQQPDLLSEQTAPFPILEDQ
CPALNLDRSNNDLLLQNNISFPKGSDLQAIQLTPISGDYSTYVMADNNNNDNDSYSNTNY
FSKNNGISPSSRSPSVAHNENVPDDSKAKKKAQNRAAQKAFRERKEARMKELQDKLLESE
RNRQSLLKEIEELRKANTEINAENRLLLRSGNENFSKDIEDDTNYKYSFPTKDEFFTSMV
LESKLNHKGKYSLKDNEIMKRNTQYTDEAGRHVLTVPATWEYLYKLSEERDFDVTYVMSK
LQGQECCHTHGPAYPRSLIDFLVEEATLNE* 
Transcription Factor
Binding site(s)
TTACTAA
TGACTCA
aTTAcTAAt
aTTACGTAAT
tACGTAAt
TTAcSTAA
gGTAATTa
agGTAATT
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator