Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Yap3p
Description Basic leucine zipper (bZIP) transcription factor
Aminoacid Sequence
Download FASTA
>YHL009C YAP3
MTPSNMDDNTSGFMKFINPQCQEEDCCIRNSLFQEDSKCIKQQPDLLSEQTAPFPILEDQ
CPALNLDRSNNDLLLQNNISFPKGSDLQAIQLTPISGDYSTYVMADNNNNDNDSYSNTNY
FSKNNGISPSSRSPSVAHNENVPDDSKAKKKAQNRAAQKAFRERKEARMKELQDKLLESE
RNRQSLLKEIEELRKANTEINAENRLLLRSGNENFSKDIEDDTNYKYSFPTKDEFFTSMV
LESKLNHKGKYSLKDNEIMKRNTQYTDEAGRHVLTVPATWEYLYKLSEERDFDVTYVMSK
LQGQECCHTHGPAYPRSLIDFLVEEATLNE* 
Transcription Factor
Binding site(s)
ATTACGTAAT
TTACTAA
TGACTCA
aTTAcTAAt
tACGTAAt
TTAcSTAA
gGTAATTa
agGTAATT
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator