Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Yrr1p
Description Zn2-Cys6 zinc-finger transcription factor that activates genes involved in multidrug resistance; paralog of Yrm1p, acting on an overlapping set of target genes
Aminoacid Sequence
Download FASTA
>YOR162C YRR1
MKRRSDALLGSFQATNVTPPSDNSNSTAGGANGSNSGTPTSTSGKKRNKLIKSCGFCRRR
KLRCDQQKPMCSTCISRNLTTCQYAEEFNKNIEKKATYGPYPNADLLKKVEELENKIRIL
EAEKNTNSSASSMYTSPNFPPLGTSVGRGSTETSSPLPDGVINPYADRYYLQSKHSGRST
LYGPTSMRTQIANSNWGFIEKYKQLWAKVKVERNKWKQNNQKTMCRELGLLDESDWQPDP
LIKQICRFLPSYNKALSILDDFFNDGACNEINVILDKAKVRRDFLDYFMPEKEVKAEGDR
SIVYILSNPKKNYYKAAVILLILCLKYFHTDVPTPIEKFFTLLKGASTAKVFYIERAQML
ILFYYHRETYSFGGDGSDLVNINECLVTTVTTIGLHLNIRETFKEHEVFMGSIESLENVW
LMAIFIDYNISCNVGRPLLINKFYLDENQDHCILNSKSKTYEGKLKRYLKLTRPMLLTLY
DRDKFPDLKAYSKRIINFVEEELGPLGHYTGENISEEVPLRESRILSMAVGLLLSFYALI
HSVLKVRNIESKNNTFQLVLINFSIIVNTTIRCYRIDKALYPEKFEASNPHLPPHMALSM
SLTAGLFSKTLVFFCSLIYFKLTLFENGLCLSNDMEVGWSDLTKLTVPLDKDLSLGTAMS
LYSSIFDRLFTVGNKELIRTMHRSSQFVIELAIERTYRTILGNVIEFRKLTEETWLAQIK
QELDPQSDNPSSEAKIVSDRQRDLSLAVPTPTPSIIPMLPSPGETKNHAKSQSEIIQMLT
DEFWANYNSGWEELINQSEFSTLFDDYKDN* 
Transcription Factor
Binding site(s)
WCCGYKKWW
cGGaxataa
cttAtHtCCGY
ttatxtccg
VxxxxTTATtTCCGY
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator